PDB entry 1vgo

View 1vgo on RCSB PDB site
Description: Crystal Structure of Archaerhodopsin-2
Class: proton transport
Keywords: retinal-binding protein, PROTON TRANSPORT
Deposited on 2004-04-28, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-06-10, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Archaerhodopsin 2
    Species: Halobacterium sp. [TaxId:29285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgoa_
  • Chain 'B':
    Compound: Archaerhodopsin 2
    Species: Halobacterium sp. [TaxId:29285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgob_
  • Heterogens: BNG, SO4, RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgoA (A:)
    qagfdllndgrpetlwlgigtllmligtfyfiargwgvtdkeareyyaitilvpgiasaa
    ylamffgigvtevelasgtvldiyyaryadwlfttplllldlallakvdrvtigtligvd
    almivtgligalsktplarytwwlfstiaflfvlyylltslrsaaakrseevrstfntlt
    alvavlwtaypilwivgtegagvvglgietlafmvldvtakvgfgfvllrsrailgetea
    pepsagadasaad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgoA (A:)
    dllndgrpetlwlgigtllmligtfyfiargwgvtdkeareyyaitilvpgiasaaylam
    ffgigvtevelasgtvldiyyaryadwlfttplllldlallakvdrvtigtligvdalmi
    vtgligalsktplarytwwlfstiaflfvlyylltslrsaaakrseevrstfntltalva
    vlwtaypilwivgtegagvvglgietlafmvldvtakvgfgfvllrsrailge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgoB (B:)
    qagfdllndgrpetlwlgigtllmligtfyfiargwgvtdkeareyyaitilvpgiasaa
    ylamffgigvtevelasgtvldiyyaryadwlfttplllldlallakvdrvtigtligvd
    almivtgligalsktplarytwwlfstiaflfvlyylltslrsaaakrseevrstfntlt
    alvavlwtaypilwivgtegagvvglgietlafmvldvtakvgfgfvllrsrailgetea
    pepsagadasaad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgoB (B:)
    dllndgrpetlwlgigtllmligtfyfiargwgvtdkeareyyaitilvpgiasaaylam
    ffgigvtevelasgtvldiyyaryadwlfttplllldlallakvdrvtigtligvdalmi
    vtgligalsktplarytwwlfstiaflfvlyylltslrsaaakrseevrstfntltalva
    vlwtaypilwivgtegagvvglgietlafmvldvtakvgfgfvllrsrailgete