PDB entry 1vgn

View 1vgn on RCSB PDB site
Description: Structure-based design of the irreversible inhibitors to metallo--lactamase (IMP-1)
Class: hydrolase
Keywords: metallo-beta-lactamase, zinc, irreversible inhibitor, hydrolase
Deposited on 2004-04-27, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.228
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase imp-1
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgna_
  • Chain 'B':
    Compound: beta-lactamase imp-1
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgnb_
  • Heterogens: ZN, OPS, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgnA (A:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgnA (A:)
    lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
    vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
    wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
    kskygkaklvvpshsevgdasllkltleqavkglnes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgnB (B:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgnB (B:)
    lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
    vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
    wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
    kskygkaklvvpshsevgdasllkltleqavkglnesk