PDB entry 1vgl

View 1vgl on RCSB PDB site
Description: Crystal structure of tetrameric KaiB from T.elongatus BP-1
Class: circadian clock protein
Keywords: circadian clock protein
Deposited on 2004-04-27, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-07-01, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Circadian clock protein kaiB
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79V61
      • engineered (63)
    Domains in SCOPe 2.07: d1vgla_
  • Chain 'B':
    Compound: Circadian clock protein kaiB
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79V61 (Start-107)
      • engineered (63)
    Domains in SCOPe 2.07: d1vglb_
  • Chain 'C':
    Compound: Circadian clock protein kaiB
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79V61
      • engineered (63)
    Domains in SCOPe 2.07: d1vglc_
  • Chain 'D':
    Compound: Circadian clock protein kaiB
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79V61
      • engineered (63)
    Domains in SCOPe 2.07: d1vgld_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vglA (A:)
    maplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkil
    atpclakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vglA (A:)
    ktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatpcl
    akvlpppvrriigdlsnrekvligldllyeeigdqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vglB (B:)
    maplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkil
    atpclakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vglB (B:)
    lrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatp
    clakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vglC (C:)
    maplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkil
    atpclakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vglC (C:)
    aplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkila
    tpclakvlpppvrriigdlsnrekvligldllyeeigdqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vglD (D:)
    maplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkil
    atpclakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vglD (D:)
    rktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatpc
    lakvlpppvrriigdlsnrekvligldllyeeigdqaeddlgl