PDB entry 1vgj

View 1vgj on RCSB PDB site
Description: Crystal structure of 2'-5' RNA ligase from Pyrococcus horikoshii
Class: ligase
Keywords: Alpha+Beta, LigT-like, STRUCTURAL GENOMICS, LIGASE
Deposited on 2004-04-27, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein PH0099
  Species: Pyrococcus horikoshii [TaxId:53953]
  Gene: PH0099
  Database cross-references and differences (RAF-indexed):
  • Uniprot O57823 (0-183)
    • modified residue (0)
    • modified residue (102)
    • modified residue (141)
  Domains in SCOPe 2.07: d1vgja_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vgjA (A:)
  mrafiaidvnesvrdslvraqdyigskeakikfverenlhitlkflgeiteeqaeeikni
  lkkiaekykkhevkvkgigvfpnpnyirviwagiendeiiremareiedelaklgfkkeg
  nfvahitlgrvkfvkdklgltmklkelanedfgsfvvdaielkkstltpkgpiyetlarf
  else