PDB entry 1vge

View 1vge on RCSB PDB site
Description:
Deposited on 1996-01-04, released 1996-06-10
The last revision prior to the SCOP 1.69 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1vgeh1, d1vgeh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1vgel1, d1vgel2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vgeH (H:)
    qvklleqsgaevkkpgasvkvsckasgysftsyglhwvrqapgqrlewmgwisagtgntk
    ysqkfrgrvtftrdtsattaymglsslrpedtavyycardpygggksefdywgqgtlvtv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vgeL (L:)
    elvmtqspsslsasvgdrvniacrasqgissalawyqqkpgkaprlliydasnlesgvps
    rfsgsgsgtdftltisslqpedfaiyycqqfnsypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec