PDB entry 1vg8

View 1vg8 on RCSB PDB site
Description: gppnhp-bound rab7
Deposited on 2004-04-23, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vg8a_
  • Chain 'B':
    Domains in SCOP 1.69: d1vg8b_
  • Chain 'C':
    Domains in SCOP 1.69: d1vg8c_
  • Chain 'D':
    Domains in SCOP 1.69: d1vg8d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vg8A (A:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg8A (A:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef
    pepi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vg8B (B:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg8B (B:)
    kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
    gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
    kidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelyn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vg8C (C:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg8C (C:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelyn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vg8D (D:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg8D (D:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef
    pepi