PDB entry 1vg7

View 1vg7 on RCSB PDB site
Description: crystal structure of octaprenyl pyrophosphate synthase from hyperthermophilic thermotoga maritima f132a/l128a/i123a/d62a mutant
Deposited on 2004-04-23, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.236
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vg7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vg7A (A:)
    mtknklnqnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveig
    eaaisslaalelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtv
    eeagnnkarraalnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpal
    legelgedlynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfp
    earqmfenrdwsglmsfmrekgilkeceetlkvlvknviienswlrdfvdgifkikiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg7A (A:)
    nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigeaaissla
    alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeagnnka
    rraalnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
    lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
    rdwsglmsfmrekgilkeceetlkvlvknviienswlrd