PDB entry 1vg7

View 1vg7 on RCSB PDB site
Description: Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132A/L128A/I123A/D62A mutant
Class: transferase
Keywords: trans-type prenyltransferase, thermophilic, TRANSFERASE
Deposited on 2004-04-23, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: octoprenyl-diphosphate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1M1
      • engineered (61)
      • engineered (122)
      • engineered (127)
      • engineered (131)
    Domains in SCOPe 2.07: d1vg7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vg7A (A:)
    mtknklnqnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveig
    eaaisslaalelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtv
    eeagnnkarraalnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpal
    legelgedlynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfp
    earqmfenrdwsglmsfmrekgilkeceetlkvlvknviienswlrdfvdgifkikiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg7A (A:)
    nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigeaaissla
    alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeagnnka
    rraalnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
    lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
    rdwsglmsfmrekgilkeceetlkvlvknviienswlrd