PDB entry 1vg5

View 1vg5 on RCSB PDB site
Description: Solution Structure of RSGI RUH-014, a UBA domain from Arabidopsis cDNA
Class: structural genomics, unknown function
Keywords: UBA domain, Arabidopsis thaliana, cDNA, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-04-23, released 2004-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rhomboid family protein
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8LB17 (7-66)
    • cloning artifact (0-6)
    • cloning artifact (67-72)
  Domains in SCOPe 2.06: d1vg5a1, d1vg5a2, d1vg5a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vg5A (A:)
  gssgssgsrqapianaavlpqsqgrvaaseeqiqklvamgfdrtqvevalaaadddltva
  veilmsqsgpssg