PDB entry 1vg5

View 1vg5 on RCSB PDB site
Description: Solution Structure of RSGI RUH-014, a UBA domain from Arabidopsis cDNA
Deposited on 2004-04-23, released 2004-10-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-23, with a file datestamp of 2004-10-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vg5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vg5A (A:)
    gssgssgsrqapianaavlpqsqgrvaaseeqiqklvamgfdrtqvevalaaadddltva
    veilmsqsgpssg