PDB entry 1vg0

View 1vg0 on RCSB PDB site
Description: The crystal structures of the REP-1 protein in complex with monoprenylated Rab7 protein
Class: protein binding/protein transport
Keywords: rab prenylation, post-translational modification, protein binding-protein transport complex
Deposited on 2004-04-22, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rab proteins geranylgeranyltransferase component A 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37727
      • engineered (230)
      • engineered (461)
      • engineered (472)
      • engineered (482)
    Domains in SCOPe 2.07: d1vg0a1, d1vg0a2
  • Chain 'B':
    Compound: Ras-related protein Rab-7
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vg0b_
  • Heterogens: CL, GER, MG, GDP, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vg0A (A:)
    madnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlk
    eyqenndvvtensmwqeqileneeaiplsskdktiqhvevfcyasqdlhkdveeagalqk
    nhasvtsaqsaeaaeaaetsclptaveplsmgsceipaeqsqcpgpesspevndaeatgk
    kensdakssteepsenvpkvqdntetpkknritysqiikegrrfnidlvskllysrglli
    dlliksnvsryaefknitrilafregtveqvpcsradvfnskqltmvekrmlmkfltfcv
    eyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtsettsctvdglkatkkflq
    clgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdkesrkckavidqf
    gqriiskhfiiedsylsentcsrvqyrqisravlitdgsvlrtdadqqvsiltvpaeepg
    sfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpyteieaeneqvek
    prllwalyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqqicpned
    fcpappnpedivldgdssqqevpessvtpetnsetpkestvlgnpeepse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg0A (A:)
    dnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlkey
    qmwqeqileneeaiplsskdktiqhvevfcyasqritysqiikegrrfnidlvskllysr
    gllidlliksnvsryaefknitrilafregtveqvpcsradvfnskqltmvekrmlmkfl
    tfcveyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamettsctvdglkatkkf
    lqclgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdkesrkckavid
    qfgqriiskhfiiedsylsentcsrvqyrqisravlitdgsvlrtdadqqvsiltvpaee
    pgsfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpyteiekprllw
    alyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqqicpnedfcpap
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vg0B (B:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg0B (B:)
    kvllkviilgdsgvgktslmnqyvnkkfsnigadfltkevmvddrlvtmqiwdtagqerf
    qslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnkidle
    nrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynefpepi
    kl