PDB entry 1vfy

View 1vfy on RCSB PDB site
Description: phosphatidylinositol-3-phosphate binding fyve domain of vps27p protein from saccharomyces cerevisiae
Class: transport protein
Keywords: fyve domain, endosome maturation, intracellular trafficking, transport protein
Deposited on 1999-04-26, released 1999-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.174
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-3-phosphate binding fyve domain of protein vps27
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: vps27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40343 (Start-67)
      • engineered (67)
    Domains in SCOPe 2.07: d1vfya1, d1vfya2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfyA (A:)
    dsktpadwidsdacmicskkfsllnrkhhcrscggvfcqehssnsiplpdlgiyepvrvc
    dscfedyefivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfyA (A:)
    dwidsdacmicskkfsllnrkhhcrscggvfcqehssnsiplpdlgiyepvrvcdscfed
    yefivtd