PDB entry 1vfw

View 1vfw on RCSB PDB site
Description: Crystal Structure of the Kif1A Motor Domain Complexed With Mg-AMPPNP
Class: transport protein
Keywords: kinesin, microtubule, motor, TRANSPORT PROTEIN
Deposited on 2004-04-19, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Fusion protein consisting of Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C and A HIS TAG
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33173 (Start-354)
      • expression tag (361)
    • Uniprot P28738 (355-360)
    Domains in SCOPe 2.08: d1vfwa1, d1vfwa2
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfwA (A:)
    magasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywsht
    spedinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiip
    qlcedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyved
    lsklavtsyndiqdlmdsgnkprtvaatnmnetssrshavfniiftqkrhdaetnittek
    vskislvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkk
    tdfipyrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrakqirntvsv
    nhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfwA (A:)
    asvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtspe
    dinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlc
    edlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedlsk
    lavtsyndiqdlmdsgnkprtvaattssrshavfniiftqkrhdaetnittekvskislv
    dlagserganinkslttlgkvisalaemdfipyrdsvltwllrenlggnsrtamvaalsp
    adinydetlstlryadrakqirntvsvnh