PDB entry 1vfr

View 1vfr on RCSB PDB site
Description: the major nad(p)h:fmn oxidoreductase from vibrio fischeri
Class: oxidoreductase
Keywords: nad(p)h, fmn, oxidoreductase, vibrio fischeri, bioluminescence
Deposited on 1998-01-09, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad(p)h:fmn oxidoreductase
    Species: Aliivibrio fischeri [TaxId:668]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vfra_
  • Chain 'B':
    Compound: nad(p)h:fmn oxidoreductase
    Species: Aliivibrio fischeri [TaxId:668]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vfrb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfrA (A:)
    mthpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakq
    rmhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafa
    sfkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadel
    kgyechvalaigyhhpsedynaslpksrkafedvitil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfrA (A:)
    thpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakqr
    mhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafas
    fkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadelk
    gyechvalaigyhhpsedynaslpksrkafedvitil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vfrB (B:)
    mthpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakq
    rmhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafa
    sfkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadel
    kgyechvalaigyhhpsedynaslpksrkafedvitil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfrB (B:)
    thpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakqr
    mhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafas
    fkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadelk
    gyechvalaigyhhpsedynaslpksrkafedvitil