PDB entry 1vfq

View 1vfq on RCSB PDB site
Description: The Crystal Structure of Human Coactosin-like Protein at 1.9 A Resolution
Class: protein binding
Keywords: Cytoskeleton, Actin-binding protein, PROTEIN BINDING
Deposited on 2004-04-19, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.166
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coactosin-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14019 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1vfqa2, d1vfqa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfqA (A:)
    smatkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlf
    afvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrke
    leedfikselkkagganydaqte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfqA (A:)
    smatkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlf
    afvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrke
    leedfikselkk