PDB entry 1vfn

View 1vfn on RCSB PDB site
Description: purine nucleoside phosphorylase
Deposited on 1996-10-08, released 1997-11-12
The last revision prior to the SCOP 1.67 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.18
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1vfn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1vfn_ (-)
    gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvpg
    hagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpn
    fevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmge
    qrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitn
    kvimdyesqgkanheevleagkqaaqkleqfvsllmasipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfn_ (-)
    gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpegrlvf
    gilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpnfevgdim
    lirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmgeqrelqeg
    tyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitnkvimdsq
    gkanheevleagkqaaqkleqfvsllmasi