PDB entry 1vfn

View 1vfn on RCSB PDB site
Description: purine nucleoside phosphorylase
Class: nucleoside phosphorylase
Keywords: transferase, glycosyltransferase, disease mutation, nucleoside phosphorylase
Deposited on 1996-10-08, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.18
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine-nucleoside phosphorylase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55859 (0-End)
      • conflict (140)
    Domains in SCOPe 2.07: d1vfna_
  • Heterogens: MG, ZN, HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfnA (A:)
    gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvpg
    hagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpn
    fevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmge
    qrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitn
    kvimdyesqgkanheevleagkqaaqkleqfvsllmasipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfnA (A:)
    gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpegrlvf
    gilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpnfevgdim
    lirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmgeqrelqeg
    tyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitnkvimdsq
    gkanheevleagkqaaqkleqfvsllmasi