PDB entry 1vfi

View 1vfi on RCSB PDB site
Description: Solution Structure of Vanabin2 (RUH-017), a Vanadium-binding Protein from Ascidia sydneiensis samea
Class: metal binding protein
Keywords: NMR, vanadium-binding, Ascidian, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, METAL BINDING PROTEIN
Deposited on 2004-04-13, released 2005-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vanadium-binding protein 2
  Species: Ascidia sydneiensis samea [TaxId:79730]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86BW2 (4-94)
    • cloning artifact (0-3)
  Domains in SCOPe 2.08: d1vfia1, d1vfia2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vfiA (A:)
  isefapvdckgqcttpcepltackekcaescetsadkktcrrnckkadcepqdkvcdacr
  mkchkacraancasecpkhehksdtcracmktnck