PDB entry 1vfg

View 1vfg on RCSB PDB site
Description: Crystal structure of tRNA nucleotidyltransferase complexed with a primer tRNA and an incoming ATP analog
Class: transferase/RNA
Keywords: TRANSFERASE, RNA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE/RNA COMPLEX
Deposited on 2004-04-13, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: poly A polymerase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66728 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1vfga1, d1vfga2
  • Chain 'B':
    Compound: poly A polymerase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66728 (1-382)
      • initiating methionine (0)
      • cloning artifact (383-389)
    Domains in SCOPe 2.07: d1vfgb1, d1vfgb2, d1vfgb3
  • Chain 'C':
    Compound: RNA (75-mer)
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: RNA (75-mer)
    Species: synthetic, synthetic
  • Heterogens: APC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfgA (A:)
    mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
    fgtahlkigklklefatarretyprpgaypkvepaslkedlirrdftinamaisvnledy
    gtlidyfgglrdlkdkvirvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavn
    lgllkeaprgrlineiklalredrfleilelyrkyrvleeiiegfqwnekvlqklyalrk
    vvdwhalefseeridygwlyllilisnldyergkhfleemsapswvretykfmkfklgsl
    keelkkakenyevyrllkplhtsvllllmleeelkekiklyleklrkvklpkekieelkk
    qglkgkelgerieelkreimnkiklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfgA (A:)
    mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
    fgtahlkigklklefatarretvepaslkedlirrdftinamaisvnledygtlidyfgg
    lrdlkdkvirvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavnlgllkeapr
    grlineiklalredrfleilelyrkyrvleeiiegfqwnekvlqklyalrkvvdwhalef
    seeridygwlyllilisnldyergkhfleemsapswvretykfmkfklgslkeelkkake
    nyevyrllkplhtsvllllmleeelkekiklyleklrkvklp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vfgB (B:)
    mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
    fgtahlkigklklefatarretyprpgaypkvepaslkedlirrdftinamaisvnledy
    gtlidyfgglrdlkdkvirvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavn
    lgllkeaprgrlineiklalredrfleilelyrkyrvleeiiegfqwnekvlqklyalrk
    vvdwhalefseeridygwlyllilisnldyergkhfleemsapswvretykfmkfklgsl
    keelkkakenyevyrllkplhtsvllllmleeelkekiklyleklrkvklpkekieelkk
    qglkgkelgerieelkreimnkiklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfgB (B:)
    mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpe
    fgtahlkigklklefatarretvepaslkedlirrdftinamaisvnledygtlidyfgg
    lrdlkdkvirvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavnlgllkeapr
    grlineiklalredrfleilelyrkyrvleeiiegfqwnekvlqklyalrkvvdwhalef
    seeridygwlyllilisnldyergkhfleemsapswvretykfmkfklgslkeelkkake
    nyevyrllkplhtsvllllmleeelkekiklyleklrkvklplkreimnkiklaaale
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.