PDB entry 1vfd

View 1vfd on RCSB PDB site
Description: human lactoferrin, n-terminal lobe mutant with arg 121 replaced by glu (r121e)
Class: iron transport
Keywords: transferrin, iron transport, glycoprotein, metal-binding
Deposited on 1996-10-01, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoferrin
    Species: Homo sapiens [TaxId:9606]
    Gene: LFN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02788
      • variant (27)
      • engineered (120)
    Domains in SCOPe 2.07: d1vfda_
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfdA (A:)
    grrrsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtld
    ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
    etagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
    cafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
    kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllf
    kdsaigfsrvppridsglylgsgyftaiqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfdA (A:)
    svqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtldggfi
    yeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglretag
    wnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcafs
    sqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdkfkd
    chlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkdsa
    igfsrvppridsglylgsgyf