PDB entry 1vfc

View 1vfc on RCSB PDB site
Description: Solution Structure Of The DNA Complex Of Human Trf2
Class: structural protein/DNA
Keywords: Myb, helix-turn-helix, telomere, protein-DNA complex, STRUCTURAL PROTEIN/DNA COMPLEX
Deposited on 2004-04-12, released 2005-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: telomeric repeat binding factor 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15554 (0-62)
  Domains in SCOPe 2.08: d1vfca1
• Chain 'B':
  Compound: Short G-rich strand
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: Short C-rich starnd
  Species: synthetic, synthetic
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vfcA (A:)
  edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
  gmn
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.