PDB entry 1vfc

View 1vfc on RCSB PDB site
Description: Solution Structure Of The DNA Complex Of Human Trf2
Class: structural protein/DNA
Keywords: Myb, helix-turn-helix, telomere, protein-DNA complex, STRUCTURAL PROTEIN/DNA COMPLEX
Deposited on 2004-04-12, released 2005-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomeric repeat binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vfca1
  • Chain 'B':
    Compound: Short G-rich strand
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: Short C-rich starnd
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vfcA (A:)
    edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
    gmn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.