PDB entry 1vf9

View 1vf9 on RCSB PDB site
Description: Solution Structure Of Human Trf2
Class: DNA binding protein
Keywords: Myb, helix-turn-helix, telomere
Deposited on 2004-04-12, released 2005-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-17, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomeric repeat binding factor 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15554 (1-63)
      • initiating methionine (0)
    Domains in SCOP 1.73: d1vf9a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vf9A (A:)
    medsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkr
    lgmn