PDB entry 1vf9

View 1vf9 on RCSB PDB site
Description: Solution Structure Of Human Trf2
Class: DNA binding protein
Keywords: Myb, helix-turn-helix, telomere, DNA BINDING PROTEIN
Deposited on 2004-04-12, released 2005-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomeric repeat binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15554 (1-63)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d1vf9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vf9A (A:)
    medsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkr
    lgmn