PDB entry 1vf7

View 1vf7 on RCSB PDB site
Description: Crystal structure of the membrane fusion protein, MexA of the multidrug transporter
Class: membrane protein
Keywords: alpha hairpin, beta barrel, MEMBRANE PROTEIN
Deposited on 2004-04-09, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.259
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7a_
  • Chain 'B':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7b_
  • Chain 'C':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7c_
  • Chain 'D':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7d_
  • Chain 'E':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7e_
  • Chain 'F':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7f_
  • Chain 'G':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7g_
  • Chain 'H':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7h_
  • Chain 'I':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7i_
  • Chain 'J':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7j_
  • Chain 'K':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7k_
  • Chain 'L':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7l_
  • Chain 'M':
    Compound: Multidrug resistance protein mexA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf7m_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vf7A (A:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7A (A:)
    tlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqa
    nlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgri
    grsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaak
    vslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlqeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vf7B (B:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7B (B:)
    tlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqa
    nlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgri
    grsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaak
    vslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vf7C (C:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7C (C:)
    tvtlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsa
    qanlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisg
    rigrsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdna
    akvslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlqegv
    kqkail
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vf7D (D:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7D (D:)
    tlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqa
    nlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgri
    grsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaak
    vslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vf7E (E:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7E (E:)
    qtvtlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqs
    aqanlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspis
    grigrsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdn
    aakvslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlqeg
    vkqkailapqqg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vf7F (F:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7F (F:)
    ntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqanl
    astqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgrigr
    savtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaakvs
    lkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vf7G (G:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7G (G:)
    vtlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaq
    anlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgr
    igrsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaa
    kvslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlqe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vf7H (H:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7H (H:)
    qtvtlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqs
    aqanlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspis
    grigrsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdn
    aakvslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlqeg
    v
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1vf7I (I:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7I (I:)
    tlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqa
    nlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgri
    grsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaak
    vslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vf7J (J:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7J (J:)
    tlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqa
    nlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgri
    grsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaak
    vslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1vf7K (K:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7K (K:)
    lntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqan
    lastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgrig
    rsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaakv
    slkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1vf7L (L:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7L (L:)
    tlntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqa
    nlastqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgri
    grsavtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaak
    vslkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaqlq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1vf7M (M:)
    aessgkseapppaqtpevgivtleaqtvtlntelpgrtnafriaevrpqvngiilkrlfk
    egsdvkagqqlyqidpatyeadyqsaqanlastqeqaqrykllvadqavskqqyadanaa
    ylqskaaveqarinlrytkvlspisgrigrsavtegalvtngqanamatvqqldpiyvdv
    tqpstallrlrrelasgqleragdnaakvslkledgsqyplegrlefsevsvdegtgsvt
    iravfpnpnnellpgmfvhaqlqegvkqkailapqqgvtrdlkgqatalvvnaqnkvelr
    vikadrvigdkwlvteglnagdkiiteglqfvqpgvevktvpaknvasaqkadaapaktd
    skghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf7M (M:)
    ntelpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqanl
    astqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgrigr
    savtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaakvs
    lkledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaql