PDB entry 1vf6

View 1vf6 on RCSB PDB site
Description: 2.1 angstrom crystal structure of the pals-1-l27n and patj l27 heterodimer complex
Deposited on 2004-04-09, released 2004-04-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.242
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vf6a_
  • Chain 'B':
    Domains in SCOP 1.71: d1vf6b_
  • Chain 'C':
    Domains in SCOP 1.71: d1vf6c_
  • Chain 'D':
    Domains in SCOP 1.71: d1vf6d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vf6A (A:)
    mklqvlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhi
    lesgketaaakferqhmdsstsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf6A (A:)
    vlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vf6B (B:)
    mklqvlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhi
    lesgketaaakferqhmdsstsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf6B (B:)
    lqvlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhile
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vf6C (C:)
    mgsshhhhhhsqdpdvedlfsslkhiqhtlvdsqsqedislllqlvqnrdfqnafkihna
    vtvhmskasppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf6C (C:)
    qdpdvedlfsslkhiqhtlvdsqsqedislllqlvqnrdfqnafkihnavt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vf6D (D:)
    mgsshhhhhhsqdpdvedlfsslkhiqhtlvdsqsqedislllqlvqnrdfqnafkihna
    vtvhmskasppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf6D (D:)
    dvedlfsslkhiqhtlvdsqsqedislllqlvqnrdfqnafkihnavt