PDB entry 1vf6

View 1vf6 on RCSB PDB site
Description: 2.1 Angstrom crystal structure of the PALS-1-L27N and PATJ L27 heterodimer complex
Class: protein binding/protein transport
Keywords: L27 domain, heterodimer, four-helical bundle, coiled-coil, hydrophobic packing interactions, PROTEIN BINDING-PROTEIN TRANSPORT COMPLEX
Deposited on 2004-04-09, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PALS1-associated tight junction protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf6a_
  • Chain 'B':
    Compound: PALS1-associated tight junction protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf6b_
  • Chain 'C':
    Compound: MAGUK p55 subfamily member 5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLB2 (14-End)
      • expression tag (11-13)
    Domains in SCOPe 2.07: d1vf6c1, d1vf6c2
  • Chain 'D':
    Compound: MAGUK p55 subfamily member 5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vf6A (A:)
    mklqvlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhi
    lesgketaaakferqhmdsstsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf6A (A:)
    vlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vf6B (B:)
    mklqvlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhi
    lesgketaaakferqhmdsstsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf6B (B:)
    lqvlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhile
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vf6C (C:)
    mgsshhhhhhsqdpdvedlfsslkhiqhtlvdsqsqedislllqlvqnrdfqnafkihna
    vtvhmskasppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf6C (C:)
    qdpdvedlfsslkhiqhtlvdsqsqedislllqlvqnrdfqnafkihnavt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vf6D (D:)
    mgsshhhhhhsqdpdvedlfsslkhiqhtlvdsqsqedislllqlvqnrdfqnafkihna
    vtvhmskasppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf6D (D:)
    dvedlfsslkhiqhtlvdsqsqedislllqlvqnrdfqnafkihnavt