PDB entry 1vf2

View 1vf2 on RCSB PDB site
Description: cGSTA1-1 in complex with S-hexyl-glutathione
Class: transferase
Keywords: glutathione, detoxification, transferase
Deposited on 2004-04-07, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase 3
    Species: Gallus gallus [TaxId:9031]
    Gene: GTA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf2a1, d1vf2a2
  • Chain 'B':
    Compound: Glutathione S-transferase 3
    Species: Gallus gallus [TaxId:9031]
    Gene: GTA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vf2b1, d1vf2b2
  • Heterogens: GTX, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vf2A (A:)
    maakpvlyyfngrgkmesirwllaaagvefeevfletreqyekllqsgilmfqqvpmvei
    dgmklvqtrailnyiagkynlygkdlkeralidmyvggtddlmgfllsfpflsaedkvkq
    cafvvekatsryfpayekvlkdhgqdflvgnrlswadihlleailmveekksdalsgfpl
    lqafkkrissiptikkflapgskrkpisddkyvetvrrvlrmyydvkph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf2A (A:)
    kpvlyyfngrgkmesirwllaaagvefeevfletreqyekllqsgilmfqqvpmveidgm
    klvqtrailnyiagkynlygkdlkeralidmyvggtddlmgfllsfpflsaedkvkqcaf
    vvekatsryfpayekvlkdhgqdflvgnrlswadihlleailmveekksdalsgfpllqa
    fkkrissiptikkflapgskrkpisddkyvetvrrvlrmyydvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vf2B (B:)
    maakpvlyyfngrgkmesirwllaaagvefeevfletreqyekllqsgilmfqqvpmvei
    dgmklvqtrailnyiagkynlygkdlkeralidmyvggtddlmgfllsfpflsaedkvkq
    cafvvekatsryfpayekvlkdhgqdflvgnrlswadihlleailmveekksdalsgfpl
    lqafkkrissiptikkflapgskrkpisddkyvetvrrvlrmyydvkph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vf2B (B:)
    kpvlyyfngrgkmesirwllaaagvefeevfletreqyekllqsgilmfqqvpmveidgm
    klvqtrailnyiagkynlygkdlkeralidmyvggtddlmgfllsfpflsaedkvkqcaf
    vvekatsryfpayekvlkdhgqdflvgnrlswadihlleailmveekksdalsgfpllqa
    fkkrissiptikkflapgskrkpisddkyvetvrrvlrmyydvkp