PDB entry 1vey

View 1vey on RCSB PDB site
Description: Crystal Structure of Peptide Deformylase from Leptospira Interrogans (LiPDF) at pH7.0
Deposited on 2004-04-06, released 2005-08-23
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.24
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Leptospira interrogans [TaxId:173]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peptide deformylase
    Species: Leptospira interrogans [TaxId:173]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1veyA (A:)
    svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
    vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
    wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld
    

    Sequence, based on observed residues (ATOM records):
    >1veyA (A:)
    svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
    vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
    wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetlds
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1veyB (B:)
    svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
    vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
    wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld
    

    Sequence, based on observed residues (ATOM records):
    >1veyB (B:)
    svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
    vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
    wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetlds