PDB entry 1vex

View 1vex on RCSB PDB site
Description: F-spondin TSR domain 4
Deposited on 2004-04-06, released 2005-04-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-spondin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35446 (2-55)
      • cloning artifact (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vexA (A:)
    gsipcllspwsewsdcsvtcgkgmrtrqrmlkslaelgdcnedleqaekcmlpecp