PDB entry 1vew

View 1vew on RCSB PDB site
Description: manganese superoxide dismutase from escherichia coli
Class: oxidoreductase
Keywords: superoxide dismutase, manganese enzyme, metalloprotein, DNA binding, oxidoreductase
Deposited on 1998-01-20, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vewa1, d1vewa2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vewb1, d1vewb2
  • Chain 'C':
    Compound: manganese superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vewc1, d1vewc2
  • Chain 'D':
    Compound: manganese superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vewd1, d1vewd2
  • Heterogens: MN, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vewA (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vewB (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vewC (C:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vewD (D:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk