PDB entry 1vev

View 1vev on RCSB PDB site
Description: Crystal structure of peptide deformylase from Leptospira Interrogans (LiPDF) at pH6.5
Class: hydrolase
Keywords: closed conformation, MES, HYDROLASE
Deposited on 2004-04-06, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.258
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Leptospira interrogans [TaxId:173]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1veva_
  • Chain 'B':
    Compound: Peptide deformylase
    Species: Leptospira interrogans [TaxId:173]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vevb_
  • Heterogens: ZN, MES, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vevA (A:)
    svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
    vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
    wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vevA (A:)
    svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
    vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
    wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetlds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vevB (B:)
    svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
    vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
    wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vevB (B:)
    svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
    vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
    wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetlds