PDB entry 1veu

View 1veu on RCSB PDB site
Description: Crystal structure of the p14/MP1 complex at 2.15 A resolution
Deposited on 2004-04-05, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.201
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1veua_
  • Chain 'B':
    Domains in SCOP 1.69: d1veub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1veuA (A:)
    maddlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqg
    sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikv
    vevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veuA (A:)
    ddlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqgsk
    lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1veuB (B:)
    gmlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrn
    gnqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepl
    tqvaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veuB (B:)
    gmlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrn
    gnqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepl
    tqva