PDB entry 1vet

View 1vet on RCSB PDB site
Description: Crystal Structure of p14/MP1 at 1.9 A resolution
Class: signaling protein/protein binding
Keywords: profilin, scaffold, adaptor, SIGNALING PROTEIN/PROTEIN BINDING COMPLEX
Deposited on 2004-04-05, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase 1 interacting protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veta_
  • Chain 'B':
    Compound: Late endosomal/lysosomal Mp1 interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vetb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vetA (A:)
    maddlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqg
    sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikv
    vevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vetA (A:)
    addlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqgs
    klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikvv
    ev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vetB (B:)
    mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
    nqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
    qvaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vetB (B:)
    mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
    nqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleep