PDB entry 1ves

View 1ves on RCSB PDB site
Description: Structure of New Antigen Receptor variable domain from sharks
Class: immune system
Keywords: ig vnar, 12y-2, immune system
Deposited on 2004-04-05, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.179
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: new antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vesa_
  • Chain 'B':
    Compound: new antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vesb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vesA (A:)
    awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
    kgsksfslrisdlrvedsgtykcqafyslplgdynysllfrgekgagtaltvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vesB (B:)
    awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
    kgsksfslrisdlrvedsgtykcqafyslplgdynysllfrgekgagtaltvk