PDB entry 1veq

View 1veq on RCSB PDB site
Description: Mycobacterium smegmatis Dps Hexagonal form
Class: DNA binding protein
Keywords: DNA-binding protein, DNA BINDING PROTEIN
Deposited on 2004-04-03, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.98 Å
R-factor: 0.202
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqa_
  • Chain 'B':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqb_
  • Chain 'C':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqc_
  • Chain 'D':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqd_
  • Chain 'E':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqe_
  • Chain 'F':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqf_
  • Chain 'G':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqg_
  • Chain 'H':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqh_
  • Chain 'I':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqi_
  • Chain 'J':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqj_
  • Chain 'K':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veqk_
  • Chain 'L':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veql_
  • Heterogens: FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1veqA (A:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqA (A:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1veqB (B:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqB (B:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1veqC (C:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqC (C:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1veqD (D:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqD (D:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1veqE (E:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqE (E:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1veqF (F:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqF (F:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1veqG (G:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqG (G:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1veqH (H:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqH (H:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1veqI (I:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqI (I:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1veqJ (J:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqJ (J:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1veqK (K:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqK (K:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1veqL (L:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veqL (L:)
    sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
    gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
    siekledldlvsqdlliahagelekfqwfvrahlesag