PDB entry 1ven

View 1ven on RCSB PDB site
Description: Crystal Structure Analysis of Y164E/maltose of Bacilus cereus Beta-amylase at pH 4.6
Class: hydrolase
Keywords: beta-alpha-barrels, optimum pH, Y164E, HYDROLASE
Deposited on 2004-04-03, released 2005-05-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36924 (0-515)
      • engineered (163)
    Domains in SCOPe 2.04: d1vena1, d1vena2
  • Heterogens: GLC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1venA (A:)
    avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
    qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
    etgtvnketlnplasdvirkeygelytafaaamkpykdviakielsggpagelrypsytt
    sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
    lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
    phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
    givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgvtpv
    mqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaernie
    fkafikskdgtvkswqtiqqswnpvplkttshtssw