PDB entry 1vem

View 1vem on RCSB PDB site
Description: Crystal Structure Analysis of Bacillus Cereus Beta-Amylase at the optimum pH (6.5)
Class: hydrolase
Keywords: beta-alpha-barrels, optimum pH, HYDROLASE
Deposited on 2004-04-03, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.176
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vema1, d1vema2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vemA (A:)
    avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
    qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
    etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
    sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
    lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
    phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
    givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgvtpv
    mqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaernie
    fkafikskdgtvkswqtiqqswnpvplkttshtssw