PDB entry 1vek

View 1vek on RCSB PDB site
Description: solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna
Deposited on 2004-03-31, released 2004-09-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-30, with a file datestamp of 2004-09-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1veka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vekA (A:)
    gssgssggeellpdgvpeevmesaqpvaneeivaqlvsmgfsqlhcqkaaintsnagvee
    amnwllshmddpdidapisgpssg