PDB entry 1vek

View 1vek on RCSB PDB site
Description: Solution Structure of RSGI RUH-011, a UBA Domain from Arabidopsis cDNA
Class: structural genomics, unknown function
Keywords: UBA domain, three helix bundle, ubiquitin associated domain, ubiquitin specific protease 14, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-03-31, released 2004-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-specific protease 14, putative
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: Arabidopsis thaliana genomic DNA, chromosome 3, TAC clone: K10D20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L6Y1 (7-77)
      • cloning artifact (0-6)
      • cloning artifact (78-83)
    Domains in SCOPe 2.08: d1veka1, d1veka2, d1veka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vekA (A:)
    gssgssggeellpdgvpeevmesaqpvaneeivaqlvsmgfsqlhcqkaaintsnagvee
    amnwllshmddpdidapisgpssg