PDB entry 1vej

View 1vej on RCSB PDB site
Description: Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
Class: structural genomics, unknown function
Keywords: UBA domain, three helix bundle, ubiquitin associated domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-03-31, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIKEN cDNA 4931431F19
    Species: Mus musculus [TaxId:10090]
    Gene: Mus musculus RIKEN cDNA 4931431F19 gene (4931431F19Rik), mRNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D4I8 (7-67)
      • cloning artifact (0-6)
      • cloning artifact (68-73)
    Domains in SCOPe 2.07: d1veja1, d1veja2, d1veja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vejA (A:)
    gssgssgaracsqssqtalptslftegryqqeleelkalgfanrdanlqalvatdgdiha
    aiemllgasgpssg