PDB entry 1vei

View 1vei on RCSB PDB site
Description: Mycobacterium smegmatis Dps
Class: DNA binding protein
Keywords: DNA-binding protein, DNA BINDING PROTEIN
Deposited on 2004-03-31, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.198
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1veia_
  • Heterogens: FE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1veiA (A:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1veiA (A:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaa