PDB entry 1veh

View 1veh on RCSB PDB site
Description: Solution structure of RSGI RUH-018, a NifU-like domain of hirip5 protein from mouse cDNA
Class: structural genomics, unknown function
Keywords: NifU-like, structural genomics, mouse cDNA, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-31, released 2004-09-30
The last revision prior to the SCOP 1.73 freeze date was dated 2004-09-30, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NifU-like protein HIRIP5
  Species: MUS MUSCULUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QZ23 (7-85)
    • cloning artifact (0-6)
    • cloning artifact (86-91)
  Domains in SCOP 1.73: d1veha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vehA (A:)
  gssgssgseeddevvamikelldtrirptvqedggdviyrgfedgivrlklqgsctscps
  siitlksgiqnmlqfyipevegveqvsgpssg