PDB entry 1veh

View 1veh on RCSB PDB site
Description: Solution structure of RSGI RUH-018, a NifU-like domain of hirip5 protein from mouse cDNA
Class: structural genomics, unknown function
Keywords: NifU-like, structural genomics, mouse cDNA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-03-31, released 2004-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NifU-like protein HIRIP5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZ23 (7-85)
      • cloning artifact (0-6)
      • cloning artifact (86-91)
    Domains in SCOPe 2.07: d1veha1, d1veha2, d1veha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vehA (A:)
    gssgssgseeddevvamikelldtrirptvqedggdviyrgfedgivrlklqgsctscps
    siitlksgiqnmlqfyipevegveqvsgpssg