PDB entry 1veg

View 1veg on RCSB PDB site
Description: Solution Structure of RSGI RUH-012, a UBA Domain from Mouse cDNA
Class: structural genomics, unknown function
Keywords: ubiquitin associated domain, UBA domain, three helix bundle, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-03-31, released 2004-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD8 ultimate buster-1
    Species: Mus musculus [TaxId:10090]
    Gene: Mus musculus adult male medulla oblongata cDNA, RIKEN full-length enriched library, clone:6330412F12 product:NY-REN-18 antigen, full insert sequence
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54729 (7-76)
      • cloning artifact (0-6)
      • cloning artifact (77-82)
    Domains in SCOPe 2.07: d1vega1, d1vega2, d1vega3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vegA (A:)
gssgssgnphmwwlqdadpennsrqaspsqesinqlvymgfdtvvaeaalrvfggnvqla
aqtlahhggslppdlqfsgpssg