PDB entry 1vef

View 1vef on RCSB PDB site
Description: Acetylornithine aminotransferase from Thermus thermophilus HB8
Class: transferase
Keywords: aminotransferase, PLP, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-03-30, released 2005-08-02
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.195
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine/acetyl-lysine aminotransferase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vefa1
  • Chain 'B':
    Compound: Acetylornithine/acetyl-lysine aminotransferase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vefb1
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vefA (A:)
    metrtledwralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlg
    hgnpevveavkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaa
    lkfarahtgrkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkr
    avdeetaavilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfaf
    ehfgivpdiltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairy
    lertrlweraaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrv
    lalqagptvirflpplviekedlervveavravla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vefA (A:)
    wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
    avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
    grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
    vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
    iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
    raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
    virflpplviekedlervveavravla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vefB (B:)
    metrtledwralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlg
    hgnpevveavkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaa
    lkfarahtgrkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkr
    avdeetaavilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfaf
    ehfgivpdiltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairy
    lertrlweraaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrv
    lalqagptvirflpplviekedlervveavravla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vefB (B:)
    wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
    avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
    grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
    vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
    iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
    raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
    virflpplviekedlervveavravla