PDB entry 1vee

View 1vee on RCSB PDB site
Description: NMR structure of the hypothetical rhodanese domain At4g01050 from Arabidopsis thaliana
Deposited on 2004-03-30, released 2005-01-25
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline-rich protein family
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIKEN cDNA RAFL06-68-J04
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9M158 (7-127)
      • cloning artifact (0-6)
      • cloning artifact (128-133)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1veeA (A:)
    gssgssgsaknaytklgtddnaqlldiratadfrqvgspnikglgkkavstvyngedkpg
    flkklslkfkdpenttlyildkfdgnselvaelvalngfksayaikdgaegprgwlnssl
    pwiepkktsgpssg