PDB entry 1veb

View 1veb on RCSB PDB site
Description: Crystal Structure of Protein Kinase A in Complex with Azepane Derivative 5
Class: transferase
Keywords: kinase-inhibitor-complex, serine/threonine-protein kinase, balanol derivative, transferase
Deposited on 2004-03-29, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (Start-349)
      • modified residue (9)
      • modified residue (196)
      • modified residue (337)
    Domains in SCOPe 2.07: d1veba_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase inhibitor, alpha form
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: I05

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vebA (A:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vebA (A:)
    seqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhy
    amkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemf
    shlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfak
    rvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyek
    ivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrk
    veapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    No sequence available.