PDB entry 1ve7

View 1ve7 on RCSB PDB site
Description: Crystal structure of an acylpeptide hydrolase/esterase from Aeropyrum pernix K1 in complex with p-nitrophenyl phosphate
Class: hydrolase
Keywords: beta propeller domain, alpha/beta hydrolase domain, HYDROLASE
Deposited on 2004-03-27, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylamino-acid-releasing enzyme
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ve7a1, d1ve7a2
  • Chain 'B':
    Compound: Acylamino-acid-releasing enzyme
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ve7b1, d1ve7b2
  • Heterogens: 4NP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ve7A (A:)
    mriimpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvkln
    repinsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdt
    geavvftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslfts
    nlssgglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdf
    ssyrptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtsht
    slstpprivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpg
    ptvvlvhggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggel
    edvsaaarwaresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyel
    sdaafrnfieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgell
    argktfeahiipdaghaintmedavkillpavfflatqrerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve7A (A:)
    fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
    dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
    atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
    vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
    twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
    vslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhg
    gpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaar
    waresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnf
    ieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgellargktfea
    hiipdaghaintmedavkillpavfflatqrer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ve7B (B:)
    mriimpvefsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvkln
    repinsvldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdt
    geavvftgatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslfts
    nlssgglrvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdf
    ssyrptaitwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtsht
    slstpprivslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpg
    ptvvlvhggpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggel
    edvsaaarwaresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyel
    sdaafrnfieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgell
    argktfeahiipdaghaintmedavkillpavfflatqrerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve7B (B:)
    fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
    dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
    atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
    vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
    twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
    vslpsgepllegglpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhg
    gpfaedsdswdtfaaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaar
    waresglaselyimgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnf
    ieqltggsreimrsrspinhvdrikeplalihpqndsrtplkpllrlmgellargktfea
    hiipdaghaintmedavkillpavfflatqrer