PDB entry 1ve3

View 1ve3 on RCSB PDB site
Description: Crystal structure of PH0226 protein from Pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: Dimer, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2004-03-26, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH0226
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ve3a1
  • Chain 'B':
    Compound: hypothetical protein PH0226
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ve3b_
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ve3A (A:)
    mgfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledyg
    fevvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeple
    lnqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvvief
    kseqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve3A (A:)
    gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
    evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
    nqvfkevrrvlkpsgkfimyftdlrellprlkeiskvipdqeertvviefsfrvrfnvwg
    ktgvellaklyftkeaeekvgnysyltvynpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ve3B (B:)
    mgfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledyg
    fevvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeple
    lnqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvvief
    kseqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve3B (B:)
    gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
    evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
    nqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvviefk
    seqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk