PDB entry 1ve2

View 1ve2 on RCSB PDB site
Description: Crystal structure of uroporphyrin-III-C-methyltransferase from thermus thermophilus
Class: transferase
Keywords: PORPHYRIN, METHYLTRANSFERASE, HEME, BIOSYNTHESIS, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-03-26, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ve2a1
  • Chain 'B':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ve2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ve2A (A:)
    mrgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvgkegygg
    ktpqeaitarlialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavg
    alsalglplthrglarsfavatghdpalplpradtlvllmplhtlgglkerllerfppet
    plallarvgwpgeavrlgrvedlpglgeglpspallvvgkvvglygellpkdhgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve2A (A:)
    mrgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvktpqeai
    tarlialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavgalsalgl
    plthrglarsfavatghdpalplpradtlvllmglkerllerfppetplallarvgwpge
    avrlgrvedlpglgeglpspallvvgkvvglygellpkdhgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ve2B (B:)
    mrgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvgkegygg
    ktpqeaitarlialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavg
    alsalglplthrglarsfavatghdpalplpradtlvllmplhtlgglkerllerfppet
    plallarvgwpgeavrlgrvedlpglgeglpspallvvgkvvglygellpkdhgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ve2B (B:)
    rgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvqeaitarl
    ialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavgalsalglplth
    rglarsfavatghdpalplpradtlvllmplhtlgglkerllerfppetplallarvgwp
    geavrlgrvedlpglgeglpspallvvgkvvglygellpk